TCHH polyclonal antibody
  • TCHH polyclonal antibody

TCHH polyclonal antibody

Ref: AB-PAB22136
TCHH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TCHH.
Información adicional
Size 100 uL
Gene Name TCHH
Gene Alias MGC157889|MGC157890|THH|THL
Gene Description trichohyalin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEY
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TCHH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7062
Iso type IgG

Enviar un mensaje


TCHH polyclonal antibody

TCHH polyclonal antibody