PARS2 polyclonal antibody
  • PARS2 polyclonal antibody

PARS2 polyclonal antibody

Ref: AB-PAB22128
PARS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PARS2.
Información adicional
Size 100 uL
Gene Name PARS2
Gene Alias DKFZp727A071|MGC14416|MGC19467|MT-PRORS
Gene Description prolyl-tRNA synthetase 2, mitochondrial (putative)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QLPVDIGEDRLAICPRCSFSANMETLDLSQMNCPACQGPLTKTKGIEVGHTFYLGTKYSSIFNAQFTNVCGKPTLAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PARS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25973
Iso type IgG

Enviar un mensaje


PARS2 polyclonal antibody

PARS2 polyclonal antibody