PLEKHG1 polyclonal antibody
  • PLEKHG1 polyclonal antibody

PLEKHG1 polyclonal antibody

Ref: AB-PAB22126
PLEKHG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLEKHG1.
Información adicional
Size 100 uL
Gene Name PLEKHG1
Gene Alias FLJ31738|KIAA1209
Gene Description pleckstrin homology domain containing, family G (with RhoGef domain) member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLKRAKRSTFLGLEADFVCCDSLRPFVSQDSLQLSEDEAPYHQATPDHGYLSLLYDSPSGNLSMPHKPVSDKLSEEVDEIWNDLENY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLEKHG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57480
Iso type IgG

Enviar un mensaje


PLEKHG1 polyclonal antibody

PLEKHG1 polyclonal antibody