SRGAP2 polyclonal antibody
  • SRGAP2 polyclonal antibody

SRGAP2 polyclonal antibody

Ref: AB-PAB22120
SRGAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SRGAP2.
Información adicional
Size 100 uL
Gene Name SRGAP2
Gene Alias FNBP2|KIAA0456|srGAP3
Gene Description SLIT-ROBO Rho GTPase activating protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMAAPVKPPATRPKPTVFPKTNATSPGVNSSTSPQST
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SRGAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23380
Iso type IgG

Enviar un mensaje


SRGAP2 polyclonal antibody

SRGAP2 polyclonal antibody