SNAP47 polyclonal antibody
  • SNAP47 polyclonal antibody

SNAP47 polyclonal antibody

Ref: AB-PAB22116
SNAP47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNAP47.
Información adicional
Size 100 uL
Gene Name SNAP47
Gene Alias C1orf142|DKFZp686M10160|FLJ12517|HEL170|IMAGE3451454|SNAP-47|SVAP1
Gene Description synaptosomal-associated protein, 47kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DDIKVHSPYEISIRQRFIGKPDMAYRLISAKMPEVIPILEVQFSKKMELLEDALVLRSARTSSPAEKSCSVWHAASGLMGRTLHREPPAGDQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNAP47.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116841
Iso type IgG

Enviar un mensaje


SNAP47 polyclonal antibody

SNAP47 polyclonal antibody