ZYG11B polyclonal antibody
  • ZYG11B polyclonal antibody

ZYG11B polyclonal antibody

Ref: AB-PAB22115
ZYG11B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZYG11B.
Información adicional
Size 100 uL
Gene Name ZYG11B
Gene Alias FLJ13456|ZYG11
Gene Description zyg-11 homolog B (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DATGVNADITITDIISGLGSNKWIQQNLQCLVLNSLTLSLEDPYERCFSRLSGLRALSITNVLFYNEDLAEVASLPRLESLDISNTSI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZYG11B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79699
Iso type IgG

Enviar un mensaje


ZYG11B polyclonal antibody

ZYG11B polyclonal antibody