ARHGEF10L polyclonal antibody
  • ARHGEF10L polyclonal antibody

ARHGEF10L polyclonal antibody

Ref: AB-PAB22108
ARHGEF10L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARHGEF10L.
Información adicional
Size 100 uL
Gene Name ARHGEF10L
Gene Alias FLJ10521|GrinchGEF|KIAA1626|RP11-473A10.1
Gene Description Rho guanine nucleotide exchange factor (GEF) 10-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARHGEF10L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55160
Iso type IgG

Enviar un mensaje


ARHGEF10L polyclonal antibody

ARHGEF10L polyclonal antibody