MRPS15 polyclonal antibody
  • MRPS15 polyclonal antibody

MRPS15 polyclonal antibody

Ref: AB-PAB22107
MRPS15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPS15.
Información adicional
Size 100 uL
Gene Name MRPS15
Gene Alias DC37|FLJ11564|MPR-S15|RPMS15|S15mt
Gene Description mitochondrial ribosomal protein S15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPS15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64960
Iso type IgG

Enviar un mensaje


MRPS15 polyclonal antibody

MRPS15 polyclonal antibody