ERO1LB polyclonal antibody
  • ERO1LB polyclonal antibody

ERO1LB polyclonal antibody

Ref: AB-PAB22105
ERO1LB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ERO1LB.
Información adicional
Size 100 uL
Gene Name ERO1LB
Gene Alias -
Gene Description ERO1-like beta (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGHSNKYLKMANNTKELEDCEQANKLGAINSTLSNQSKEAFIDWARYDDSRDHFCELDDE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ERO1LB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56605
Iso type IgG

Enviar un mensaje


ERO1LB polyclonal antibody

ERO1LB polyclonal antibody