LYSMD1 polyclonal antibody
  • LYSMD1 polyclonal antibody

LYSMD1 polyclonal antibody

Ref: AB-PAB22099
LYSMD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LYSMD1.
Información adicional
Size 100 uL
Gene Name LYSMD1
Gene Alias MGC35223|RP11-68I18.5|SB145
Gene Description LysM, putative peptidoglycan-binding, domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LYSMD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388695
Iso type IgG

Enviar un mensaje


LYSMD1 polyclonal antibody

LYSMD1 polyclonal antibody