CCDC18 polyclonal antibody
  • CCDC18 polyclonal antibody

CCDC18 polyclonal antibody

Ref: AB-PAB22096
CCDC18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC18.
Información adicional
Size 100 uL
Gene Name CCDC18
Gene Alias NY-SAR-41|RP4-717I23.1|dJ717I23.1
Gene Description coiled-coil domain containing 18
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HQVESVKDQNQHTMNKQYEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTKKCSQLLTLEKQLEEKI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC18.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 343099
Iso type IgG

Enviar un mensaje


CCDC18 polyclonal antibody

CCDC18 polyclonal antibody