TIPRL polyclonal antibody
  • TIPRL polyclonal antibody

TIPRL polyclonal antibody

Ref: AB-PAB22094
TIPRL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TIPRL.
Información adicional
Size 100 uL
Gene Name TIPRL
Gene Alias MGC3794|TIP|TIP41|dJ69E11.3
Gene Description TIP41, TOR signaling pathway regulator-like (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNATDALRCVNNYQGMLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TIPRL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 261726
Iso type IgG

Enviar un mensaje


TIPRL polyclonal antibody

TIPRL polyclonal antibody