C8orf74 polyclonal antibody
  • C8orf74 polyclonal antibody

C8orf74 polyclonal antibody

Ref: AB-PAB22091
C8orf74 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C8orf74.
Información adicional
Size 100 uL
Gene Name C8orf74
Gene Alias -
Gene Description chromosome 8 open reading frame 74
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CQAVHTQMELLQELLQRQIQNTFAILDLKLQKKTLNLNAPTPIPPPITSHAGQEEALKPQRASKGKKAKARK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C8orf74.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 203076
Iso type IgG

Enviar un mensaje


C8orf74 polyclonal antibody

C8orf74 polyclonal antibody