FAM91A1 polyclonal antibody
  • FAM91A1 polyclonal antibody

FAM91A1 polyclonal antibody

Ref: AB-PAB22089
FAM91A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM91A1.
Información adicional
Size 100 uL
Gene Name FAM91A1
Gene Alias DKFZp666B104|FLJ23790
Gene Description family with sequence similarity 91, member A1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHGIGETVHVPFPFDETELQGEFTRVNMGVHKALQILRNRVDLQHLCGYVTMLNASSQLADRKLSDASDERGEPDLASGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM91A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 157769
Iso type IgG

Enviar un mensaje


FAM91A1 polyclonal antibody

FAM91A1 polyclonal antibody