UNK polyclonal antibody
  • UNK polyclonal antibody

UNK polyclonal antibody

Ref: AB-PAB22088
UNK polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UNK.
Información adicional
Size 100 uL
Gene Name UNK
Gene Alias KIAA1753|ZC3H5|ZC3HDC5
Gene Description unkempt homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IYKSTKCNDMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSSPHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGES
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UNK.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85451
Iso type IgG

Enviar un mensaje


UNK polyclonal antibody

UNK polyclonal antibody