HINT3 polyclonal antibody
  • HINT3 polyclonal antibody

HINT3 polyclonal antibody

Ref: AB-PAB22086
HINT3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HINT3.
Información adicional
Size 100 uL
Gene Name HINT3
Gene Alias FLJ33126|FLJ99898|HINT4|MGC22976
Gene Description histidine triad nucleotide binding protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HINT3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 135114
Iso type IgG

Enviar un mensaje


HINT3 polyclonal antibody

HINT3 polyclonal antibody