DOPEY1 polyclonal antibody
  • DOPEY1 polyclonal antibody

DOPEY1 polyclonal antibody

Ref: AB-PAB22084
DOPEY1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DOPEY1.
Información adicional
Size 100 uL
Gene Name DOPEY1
Gene Alias FLJ35610|KIAA1117|dJ202D23.2
Gene Description dopey family member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSVAMVTGENINSVEPAQPLSPNQGRVAVVIRPPLTQGNL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DOPEY1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23033
Iso type IgG

Enviar un mensaje


DOPEY1 polyclonal antibody

DOPEY1 polyclonal antibody