NUP153 polyclonal antibody
  • NUP153 polyclonal antibody

NUP153 polyclonal antibody

Ref: AB-PAB22083
NUP153 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NUP153.
Información adicional
Size 100 uL
Gene Name NUP153
Gene Alias HNUP153|N153
Gene Description nucleoporin 153kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NUP153.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9972
Iso type IgG

Enviar un mensaje


NUP153 polyclonal antibody

NUP153 polyclonal antibody