PNRC2 polyclonal antibody
  • PNRC2 polyclonal antibody

PNRC2 polyclonal antibody

Ref: AB-PAB22077
PNRC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PNRC2.
Información adicional
Size 100 uL
Gene Name PNRC2
Gene Alias FLJ20312|MGC99541
Gene Description proline-rich nuclear receptor coactivator 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NNQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (0.04-0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PNRC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55629
Iso type IgG

Enviar un mensaje


PNRC2 polyclonal antibody

PNRC2 polyclonal antibody