FAM212B polyclonal antibody
  • FAM212B polyclonal antibody

FAM212B polyclonal antibody

Ref: AB-PAB22075
FAM212B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM212B.
Información adicional
Size 100 uL
Gene Name FAM212B
Gene Alias C1orf183
Gene Description family with sequence similarity 212, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EHPCWEGGRGPARPTVCSPSSQPSLGSSTKFPSHRSVCGRDLAPLPRTQPHQSCAQQGPERVEPDDWTSTLMSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM212B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55924
Iso type IgG

Enviar un mensaje


FAM212B polyclonal antibody

FAM212B polyclonal antibody