ZNF642 polyclonal antibody
  • ZNF642 polyclonal antibody

ZNF642 polyclonal antibody

Ref: AB-PAB22073
ZNF642 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF642.
Información adicional
Size 100 uL
Gene Name ZNF642
Gene Alias FLJ16030|RP11-656D10.2|Zfp69
Gene Description zinc finger protein 642
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EEPWMAEKEGPGDPSSDLKSKIETIESTAKSTISQERLYHGIMMESFMRDDIIYSTLRKVSTYDDVLERHQETC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF642.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339559
Iso type IgG

Enviar un mensaje


ZNF642 polyclonal antibody

ZNF642 polyclonal antibody