VEZF1 polyclonal antibody
  • VEZF1 polyclonal antibody

VEZF1 polyclonal antibody

Ref: AB-PAB22056
VEZF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VEZF1.
Información adicional
Size 100 uL
Gene Name VEZF1
Gene Alias DB1|ZNF161
Gene Description vascular endothelial zinc finger 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFSITSSVSSGTMSNPVTVAAAMSMRSPVNVSSAVNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPVTITSPMNLPTPMTLAAPLNIAMRPVES
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VEZF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7716
Iso type IgG

Enviar un mensaje


VEZF1 polyclonal antibody

VEZF1 polyclonal antibody