PHLDA3 polyclonal antibody
  • PHLDA3 polyclonal antibody

PHLDA3 polyclonal antibody

Ref: AB-PAB22046
PHLDA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PHLDA3.
Información adicional
Size 100 uL
Gene Name PHLDA3
Gene Alias TIH1
Gene Description pleckstrin homology-like domain, family A, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PHLDA3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23612
Iso type IgG

Enviar un mensaje


PHLDA3 polyclonal antibody

PHLDA3 polyclonal antibody