ATXN3L polyclonal antibody
  • ATXN3L polyclonal antibody

ATXN3L polyclonal antibody

Ref: AB-PAB22032
ATXN3L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATXN3L.
Información adicional
Size 100 uL
Gene Name ATXN3L
Gene Alias FLJ59638|MGC168806|MGC168807|MJDL
Gene Description ataxin 3-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LELSRQETNREDEHLRSTIELSMQGSSGNTSQDLPKTSCVTPASEQPKKIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEGTVQAAVDTI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATXN3L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92552
Iso type IgG

Enviar un mensaje


ATXN3L polyclonal antibody

ATXN3L polyclonal antibody