C1orf114 polyclonal antibody
  • C1orf114 polyclonal antibody

C1orf114 polyclonal antibody

Ref: AB-PAB22012
C1orf114 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf114.
Información adicional
Size 100 uL
Gene Name C1orf114
Gene Alias FLJ25846|RP1-206D15.2
Gene Description chromosome 1 open reading frame 114
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EVRRYIMEKIVQANKLLQNQEPVNDKRERKLKFKDQLVDLEVPPLEDTTTSKNYFENERNMFGKLSQLCISNDFGQEDVLLSLTNGSCE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf114.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57821
Iso type IgG

Enviar un mensaje


C1orf114 polyclonal antibody

C1orf114 polyclonal antibody