FAM54B polyclonal antibody
  • FAM54B polyclonal antibody

FAM54B polyclonal antibody

Ref: AB-PAB22010
FAM54B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM54B.
Información adicional
Size 100 uL
Gene Name FAM54B
Gene Alias HYST1888|MST116|MSTP116
Gene Description family with sequence similarity 54, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SEERLLALKKPALPALSRTTELQDELSHLRSQIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM54B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56181
Iso type IgG

Enviar un mensaje


FAM54B polyclonal antibody

FAM54B polyclonal antibody