UFSP1 polyclonal antibody
  • UFSP1 polyclonal antibody

UFSP1 polyclonal antibody

Ref: AB-PAB22004
UFSP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UFSP1.
Información adicional
Size 100 uL
Gene Name UFSP1
Gene Alias UFSP
Gene Description UFM1-specific peptidase 1 (non-functional)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGPVMVGGDADARS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UFSP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 402682
Iso type IgG

Enviar un mensaje


UFSP1 polyclonal antibody

UFSP1 polyclonal antibody