VANGL2 polyclonal antibody
  • VANGL2 polyclonal antibody

VANGL2 polyclonal antibody

Ref: AB-PAB21998
VANGL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VANGL2.
Información adicional
Size 100 uL
Gene Name VANGL2
Gene Alias KIAA1215|LPP1|LTAP|MGC119403|MGC119404|STB1|STBM|STBM1
Gene Description vang-like 2 (van gogh, Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VANGL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57216
Iso type IgG

Enviar un mensaje


VANGL2 polyclonal antibody

VANGL2 polyclonal antibody