ASCL3 polyclonal antibody
  • ASCL3 polyclonal antibody

ASCL3 polyclonal antibody

Ref: AB-PAB21997
ASCL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ASCL3.
Información adicional
Size 100 uL
Gene Name ASCL3
Gene Alias HASH3|SGN1|bHLHa42
Gene Description achaete-scute complex homolog 3 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ASCL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56676
Iso type IgG

Enviar un mensaje


ASCL3 polyclonal antibody

ASCL3 polyclonal antibody