Ver mas grande
VN1R4 polyclonal antibody
AB-PAB21995
Producto nuevo
VN1R4 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | VN1R4 |
| Gene Alias | V1RL4 |
| Gene Description | vomeronasal 1 receptor 4 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P |
| Immunogen Prot. Seq | TGKWNYTNITVNEDLGYCSGGGNNKIAQTLRAMLL |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:20-1:50)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human VN1R4. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 317703 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant VN1R4.