TMEM69 polyclonal antibody
  • TMEM69 polyclonal antibody

TMEM69 polyclonal antibody

Ref: AB-PAB21994
TMEM69 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM69.
Información adicional
Size 100 uL
Gene Name TMEM69
Gene Alias C1orf154|FLJ21029|MGC104183|RP11-767N6.4
Gene Description transmembrane protein 69
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PVGLRTSRTDILSLKMSLQQNFSPCPRPWLSSSFPAYMSKTQCYHTSPCSFKKQQKQALLARPSSTITYLTDSPKPALCVTLAGLIPFVAPPLV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM69.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51249
Iso type IgG

Enviar un mensaje


TMEM69 polyclonal antibody

TMEM69 polyclonal antibody