LARP7 polyclonal antibody
  • LARP7 polyclonal antibody

LARP7 polyclonal antibody

Ref: AB-PAB21983
LARP7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LARP7.
Información adicional
Size 100 uL
Gene Name LARP7
Gene Alias DKFZp564K112|HDCMA18P|MGC104360|PIP7S
Gene Description La ribonucleoprotein domain family, member 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq DSGVPQNTGMKNEKTANREECRTQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTLAAISEVLYVDLLEGDTECHA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LARP7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51574
Iso type IgG

Enviar un mensaje


LARP7 polyclonal antibody

LARP7 polyclonal antibody