FSBP polyclonal antibody
  • FSBP polyclonal antibody

FSBP polyclonal antibody

Ref: AB-PAB21975
FSBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FSBP.
Información adicional
Size 100 uL
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SNISEPTKKVMEMIPQISSFCLVRDRNHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (0.04-0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FSBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 100861412
Iso type IgG

Enviar un mensaje


FSBP polyclonal antibody

FSBP polyclonal antibody