AMPD1 polyclonal antibody
  • AMPD1 polyclonal antibody

AMPD1 polyclonal antibody

Ref: AB-PAB21974
AMPD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AMPD1.
Información adicional
Size 100 uL
Gene Name AMPD1
Gene Alias MAD|MADA
Gene Description adenosine monophosphate deaminase 1 (isoform M)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVANE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AMPD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 270
Iso type IgG

Enviar un mensaje


AMPD1 polyclonal antibody

AMPD1 polyclonal antibody