MICALL2 polyclonal antibody
  • MICALL2 polyclonal antibody

MICALL2 polyclonal antibody

Ref: AB-PAB21966
MICALL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MICALL2.
Información adicional
Size 100 uL
Gene Name MICALL2
Gene Alias FLJ23471|FLJ41996|FLJ44858|FLJ45410|JRAB|MGC46023|MICAL-L2
Gene Description MICAL-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MICALL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79778
Iso type IgG

Enviar un mensaje


MICALL2 polyclonal antibody

MICALL2 polyclonal antibody