FAM135B polyclonal antibody
  • FAM135B polyclonal antibody

FAM135B polyclonal antibody

Ref: AB-PAB21963
FAM135B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM135B.
Información adicional
Size 100 uL
Gene Name FAM135B
Gene Alias C8ORFK32|MGC126009|MGC126010|MGC33221
Gene Description family with sequence similarity 135, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DRTGLSKVVVGGSHQNAISSDKTTLHELSTLGKGIDQEGKMVLLSLKLTPSEPCDPLSSTLREPLDIRSSLKDSHTEEQEELSVLSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM135B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51059
Iso type IgG

Enviar un mensaje


FAM135B polyclonal antibody

FAM135B polyclonal antibody