KLHL38 polyclonal antibody
  • KLHL38 polyclonal antibody

KLHL38 polyclonal antibody

Ref: AB-PAB21958
KLHL38 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KLHL38.
Información adicional
Size 100 uL
Gene Name KLHL38
Gene Alias C8ORFK36
Gene Description kelch-like 38 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VIVGGYTRRILAYDPQSNKFVKCADMKDRRMHHGATVMGNKLYVTGGRRLTTDCNIEDSASFDCYDPETDTWTSQGQLPHKLFDHA
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLHL38.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340359
Iso type IgG

Enviar un mensaje


KLHL38 polyclonal antibody

KLHL38 polyclonal antibody