OTUD6B polyclonal antibody
  • OTUD6B polyclonal antibody

OTUD6B polyclonal antibody

Ref: AB-PAB21947
OTUD6B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OTUD6B.
Información adicional
Size 100 uL
Gene Name OTUD6B
Gene Alias CGI-77|DUBA5
Gene Description OTU domain containing 6B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OTUD6B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51633
Iso type IgG

Enviar un mensaje


OTUD6B polyclonal antibody

OTUD6B polyclonal antibody