KIF2B polyclonal antibody
  • KIF2B polyclonal antibody

KIF2B polyclonal antibody

Ref: AB-PAB21945
KIF2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIF2B.
Información adicional
Size 100 uL
Gene Name KIF2B
Gene Alias -
Gene Description kinesin family member 2B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ISPGMTSCENTLNTLRYANRVKKLNVDVRPYHRGHYPIGHEAPRMLKSHIGNSEMSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIF2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84643
Iso type IgG

Enviar un mensaje


KIF2B polyclonal antibody

KIF2B polyclonal antibody