LOC201229 polyclonal antibody
  • LOC201229 polyclonal antibody

LOC201229 polyclonal antibody

Ref: AB-PAB21943
LOC201229 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC201229.
Información adicional
Size 100 uL
Gene Name LOC201229
Gene Alias HSD24
Gene Description hypothetical protein LOC201229
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QLYRYLLRCCQQLPTKGIQQHYKHAVRQSFRVHSDEDNPERIQQIIKRAIEDADWIM
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LOC201229.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201229
Iso type IgG

Enviar un mensaje


LOC201229 polyclonal antibody

LOC201229 polyclonal antibody