C17orf58 polyclonal antibody
  • C17orf58 polyclonal antibody

C17orf58 polyclonal antibody

Ref: AB-PAB21942
C17orf58 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C17orf58.
Información adicional
Size 100 uL
Gene Name C17orf58
Gene Alias MGC138278
Gene Description chromosome 17 open reading frame 58
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FRVHMLALDSSSCNKPCPEFKPGSRYIVMGHIYHKRRQLPTALLQVLRGRLRPGDGLLRSSSSYVKRFNRKREGQIQGAIH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C17orf58.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284018
Iso type IgG

Enviar un mensaje


C17orf58 polyclonal antibody

C17orf58 polyclonal antibody