APIP polyclonal antibody
  • APIP polyclonal antibody

APIP polyclonal antibody

Ref: AB-PAB21940
APIP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant APIP.
Información adicional
Size 100 uL
Gene Name APIP
Gene Alias APIP2|CGI-29|CGI29|MMRP19|dJ179L10.2
Gene Description APAF1 interacting protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQPEDMFVC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human APIP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51074
Iso type IgG

Enviar un mensaje


APIP polyclonal antibody

APIP polyclonal antibody