ABHD9 polyclonal antibody
  • ABHD9 polyclonal antibody

ABHD9 polyclonal antibody

Ref: AB-PAB21930
ABHD9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ABHD9.
Información adicional
Size 100 uL
Gene Name ABHD9
Gene Alias FLJ22408|MGC131519
Gene Description abhydrolase domain containing 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SELEAFLYNFSQPGGLTGPLNYYRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFLQDLLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ABHD9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79852
Iso type IgG

Enviar un mensaje


ABHD9 polyclonal antibody

ABHD9 polyclonal antibody