TSPAN13 polyclonal antibody
  • TSPAN13 polyclonal antibody

TSPAN13 polyclonal antibody

Ref: AB-PAB21923
TSPAN13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TSPAN13.
Información adicional
Size 100 uL
Gene Name TSPAN13
Gene Alias FLJ22934|NET-6|TM4SF13
Gene Description tetraspanin 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TSPAN13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27075
Iso type IgG

Enviar un mensaje


TSPAN13 polyclonal antibody

TSPAN13 polyclonal antibody