FAM20B polyclonal antibody
  • FAM20B polyclonal antibody

FAM20B polyclonal antibody

Ref: AB-PAB21922
FAM20B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM20B.
Información adicional
Size 100 uL
Gene Name FAM20B
Gene Alias -
Gene Description family with sequence similarity 20, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDEGASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVLKSALKSAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLVED
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM20B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9917
Iso type IgG

Enviar un mensaje


FAM20B polyclonal antibody

FAM20B polyclonal antibody