ZNF445 polyclonal antibody
  • ZNF445 polyclonal antibody

ZNF445 polyclonal antibody

Ref: AB-PAB21921
ZNF445 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF445.
Información adicional
Size 100 uL
Gene Name ZNF445
Gene Alias MGC126535|ZKSCAN15|ZNF168
Gene Description zinc finger protein 445
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QPKGNPVAAPTGDDLQSKTNKFILNQEPLEEAETLAVSSGCPATSVSEGIGLRESFQQKSRQKDQCENPIQVRVKKEETNFSHRTGKDSEVSGSNSLDLKHVTYLRVSGRKESLKHGCGKHFRMSSHHYDYKKYGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF445.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 353274
Iso type IgG

Enviar un mensaje


ZNF445 polyclonal antibody

ZNF445 polyclonal antibody