HIVEP3 polyclonal antibody
  • HIVEP3 polyclonal antibody

HIVEP3 polyclonal antibody

Ref: AB-PAB21918
HIVEP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HIVEP3.
Información adicional
Size 100 uL
Gene Name HIVEP3
Gene Alias FLJ16752|KBP-1|KBP1|KIAA1555|KRC|SHN3|Schnurri-3|ZAS3|ZNF40C
Gene Description human immunodeficiency virus type I enhancer binding protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HIVEP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 59269
Iso type IgG

Enviar un mensaje


HIVEP3 polyclonal antibody

HIVEP3 polyclonal antibody