LAMP5 polyclonal antibody
  • LAMP5 polyclonal antibody

LAMP5 polyclonal antibody

Ref: AB-PAB21915
LAMP5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LAMP5.
Información adicional
Size 100 uL
Gene Name LAMP5
Gene Alias BAD-LAMP|BADLAMP|C20orf103|LAMP-5|UNC-43
Gene Description lysosomal-associated membrane protein family, member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq FIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LAMP5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 24141
Iso type IgG

Enviar un mensaje


LAMP5 polyclonal antibody

LAMP5 polyclonal antibody