EVI5 polyclonal antibody
  • EVI5 polyclonal antibody

EVI5 polyclonal antibody

Ref: AB-PAB21894
EVI5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EVI5.
Información adicional
Size 100 uL
Gene Name EVI5
Gene Alias NB4S
Gene Description ecotropic viral integration site 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EVI5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7813
Iso type IgG

Enviar un mensaje


EVI5 polyclonal antibody

EVI5 polyclonal antibody