UBE3D polyclonal antibody
  • UBE3D polyclonal antibody

UBE3D polyclonal antibody

Ref: AB-PAB21883
UBE3D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UBE3D.
Información adicional
Size 100 uL
Gene Name UBE3D
Gene Alias RP4-751H9.1|C6orf157|H10BH|UBE2CBP|YJR141W
Gene Description ubiquitin protein ligase E3D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SLVIESLRNSKYIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHPLTLPSATCLELLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UBE3D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90025
Iso type IgG

Enviar un mensaje


UBE3D polyclonal antibody

UBE3D polyclonal antibody